PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 272aa    MW: 29279.6 Da    PI: 6.5144
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020170genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.6e-141091571058
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  + +NRe+ArrsR+RK+a +  Le  v++L++e  +L k+l+  ++++ +
  Lus10020170 109 MVSNRESARRSRRRKQAHLTDLEIQVEQLTGESASLYKQLSDATQQYRN 157
                  789**********************************999999888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-8100164IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.26E-10108155No hitNo description
PfamPF001705.8E-11109156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-10109157No hitNo description
PROSITE profilePS502179.105112154IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEDQKPRDLK RRASDGGLMV KQGFVNSASQ PAAAAAYSVR DDKFRGEFQG FANEIEGFFG  60
DIYSDDLFTF KTPDSINGFA ACGGLDSLLW SHNVNSKEYN NSVPINSQMV SNRESARRSR  120
RRKQAHLTDL EIQVEQLTGE SASLYKQLSD ATQQYRNADT NHRVLKSDVE ALRAKVKLAE  180
DMVARGSLTC SMNLLLPNNP PPPIPPHQVL NSHITLSPRV ANVSPTITVQ GGGGGGGDDV  240
TYGGIGNPSS ISNHGVLSEA AVSCASTDIW P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116123RRSRRRKQ
2118123SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382195.17e-64hypothetical protein POPTR_0006s29250g
SwissprotQ9FUD32e-43BZIP9_ARATH; Basic leucine zipper 9
TrEMBLU5GEY17e-64U5GEY1_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29250.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41953458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.13e-28basic leucine zipper 9